EPOR Rabbit Polyclonal Antibody

CAT#: TA334649

Rabbit Polyclonal Anti-Epor Antibody

Product Images

WB Suggested Anti-Epor Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Epor antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: erythropoietin receptor
• Database Link:
  NP_000112
  Entrez Gene 13857 Mouse
  UniProt ID P19235
• Background: Epor is a receptor for erythropoietin. Epor mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, Epor can also activate STAT1 and STAT3. Epor may also activate the LYN tyrosine kinase.
• Synonyms: EPO-R
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway