Antibodies

Jump to Filters
View as table Download
GCDH (C-term) Rabbit Polyclonal Antibody
AP51799PU-N

USD 450.00

2 Weeks

GCDH (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 335-365 amino acids from the C-terminal region of Human GCD / GCDH
GCDH Rabbit Polyclonal Antibody
TA332367

USD 310.00

5 Days

Rabbit Polyclonal Anti-GCDH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the C terminal of human GCDH. Synthetic peptide located within the following region: IARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG
GCDH Rabbit Polyclonal Antibody
TA331987

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gcdh Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV
GCDH Rabbit Polyclonal Antibody
TA332368

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the N terminal of human GCDH. Synthetic peptide located within the following region: SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA
GCDH Rabbit Polyclonal Antibody
TA365846

USD 380.00

4 Weeks

GCDH rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GCDH
GCDH Rabbit Polyclonal Antibody
TA376514

USD 220.00

3 Weeks

GCDH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 149-438 of human GCDH (NP_000150.1).
Modifications Unmodified