Antibodies

Jump to Filters
View as table Download
GJA3 Rabbit Polyclonal Antibody
TA341673

USD 375.00

5 Days

Rabbit Polyclonal Anti-GJA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GJA3 antibody: synthetic peptide directed towards the N terminal of human GJA3. Synthetic peptide located within the following region: ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS
Gja3 Rabbit Polyclonal Antibody
TA363773

USD 360.00

5 Days

GJA3 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse GJA3