Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G. Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL |
Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the N terminal of human HNF4G. Synthetic peptide located within the following region: MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCA |
Rabbit Polyclonal Anti-HNF4G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4G antibody: synthetic peptide directed towards the C terminal of human HNF4G. Synthetic peptide located within the following region: QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS |
Rabbit Polyclonal Anti-Hnf4g Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hnf4g antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hnf4g. Synthetic peptide located within the following region: DPLTGQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEPYKITANQASV |
Hnf4g Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of MOUSE Hnf4g |
HNF4G Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 366-445 of human HNF4G (NP_004124.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
