HNF4 gamma (HNF4G) Rabbit Polyclonal Antibody
Other products for "HNF4G"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Hnf4g antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hnf4g. Synthetic peptide located within the following region: DPLTGQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEPYKITANQASV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | hepatocyte nuclear factor 4 gamma |
Database Link | |
Background | Transcription factor. Has a lower transcription activation potential than HNF4-alpha. |
Synonyms | NR2A2; NR2A3 |
Note | Immunogen Sequence Homology: Horse: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Human: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 85% |
Reference Data | |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.