HNF4 gamma (HNF4G) Rabbit Polyclonal Antibody

CAT#: TA342310

Rabbit Polyclonal Anti-Hnf4g Antibody

Product Images

Host: Rabbit; Target Name: Hnf4g; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Hnf4g antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hnf4g. Synthetic peptide located within the following region: DPLTGQTILLGPMSTLVHTDQIATPETPLPSPPQGSGQEPYKITANQASV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: hepatocyte nuclear factor 4 gamma
• Database Link:
  NP_004124
  Entrez Gene 30942 Mouse
  UniProt ID Q14541
• Background: Transcription factor. Has a lower transcription activation potential than HNF4-alpha.
• Synonyms: NR2A2; NR2A3
• Note: Immunogen Sequence Homology: Horse: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Human: 93%; Rabbit: 93%; Guinea pig: 93%; Sheep: 85%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young