Antibodies

Jump to Filters
View as table Download
P4HA3 Rabbit Polyclonal Antibody
TA334343

USD 375.00

5 Days

Rabbit Polyclonal Anti-P4HA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-P4HA3 antibody is: synthetic peptide directed towards the N-terminal region of Human P4HA3. Synthetic peptide located within the following region: EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD
P4HA3 Rabbit Polyclonal Antibody
TA379563

USD 220.00

3 Weeks

P4HA3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-110 of human P4HA3 (NP_878907.1).
Modifications Unmodified