P4HA3 Rabbit Polyclonal Antibody

CAT#: TA334343

Rabbit Polyclonal Anti-P4HA3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "P4HA3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-P4HA3 antibody is: synthetic peptide directed towards the N-terminal region of Human P4HA3. Synthetic peptide located within the following region: EDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGYEKVEQD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name prolyl 4-hydroxylase subunit alpha 3
Background This gene encodes a component of prolyl 4-hydroxylase, a key enzyme in collagen synthesis composed of two identical alpha subunits and two beta subunits. The encoded protein is one of several different types of alpha subunits and provides the major part of the catalytic site of the active enzyme. In collagen and related proteins, prolyl 4-hydroxylase catalyzes the formation of 4-hydroxyproline that is essential to the proper three-dimensional folding of newly synthesized procollagen chains. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.
Synonyms 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase); alpha III subunit; alpha polypeptide III; C-P4H alpha III; collagen prolyl 4-hydroxylase alpha(III); procollagen-proline; prolyl 4-hydroxylase
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways Arginine and proline metabolism, Metabolic pathways

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.