Antibodies

Jump to Filters
View as table Download
Protein S (PROS1) Rabbit Polyclonal Antibody
TA308822

USD 415.00

2 Weeks

Rabbit polyclonal antibody to protein S (alpha) (protein S (alpha))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 209 and 477 of Protein S (Uniprot ID#P07225)
Protein S (PROS1) Sheep Polyclonal Antibody
BP792

USD 340.00

5 Days

Protein S (PROS1) sheep polyclonal antibody, Ig Fraction

Applications ELISA, WB
Immunogen Highly pure Protein S, prepared from Human plasma by chromatographic methods
Protein S (PROS1) Rabbit Polyclonal Antibody
TA335142

USD 375.00

5 Days

Rabbit polyclonal Anti-PROS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL
Protein S (PROS1) Rabbit Polyclonal Antibody
TA335143

USD 375.00

5 Days

Rabbit polyclonal Anti-Pros1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Pros1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS
Protein S (PROS1) Rabbit Polyclonal Antibody
TA380400

USD 220.00

3 Weeks

PROS1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 405-676 of human PROS1 (NP_000304.2).
Modifications Unmodified