Antibodies

View as table Download

PSCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PSCA

Rabbit polyclonal Prostate Stem Cell Antigen antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Prostate Stem Cell Antigen antibody.

Rabbit anti-PSCA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PSCA

Rabbit Polyclonal Anti-PSCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSCA antibody: synthetic peptide directed towards the C terminal of human PSCA. Synthetic peptide located within the following region: TVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILAL

PSCA Rabbit monoclonal antibody,clone OTIR2A2

Applications WB
Reactivities Human
Conjugation Unconjugated

PSCA Rabbit monoclonal antibody,clone OTIR2A2

Applications WB
Reactivities Human
Conjugation Unconjugated

PSCA Rabbit monoclonal antibody,clone OTIR4B1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PSCA Rabbit monoclonal antibody,clone OTIR4B1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated