PSCA Rabbit Polyclonal Antibody

CAT#: TA346414

Rabbit Polyclonal Anti-PSCA Antibody

Product Images

WB Suggested Anti-PSCA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSCA antibody: synthetic peptide directed towards the C terminal of human PSCA. Synthetic peptide located within the following region: TVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILAL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: prostate stem cell antigen
• Database Link:
  NP_005663
  Entrez Gene 8000 Human
  UniProt ID O43653
• Background: This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants.
• Synonyms: PRO232
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%