Antibodies

Jump to Filters
View as table Download
BOLA1 Rabbit Polyclonal Antibody
TA329894

USD 375.00

5 Days

Rabbit Polyclonal Anti-CGI Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CGI-143 antibody: synthetic peptide directed towards the N terminal of human CGI-143. Synthetic peptide located within the following region: AGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVV
Bola1 Rabbit Polyclonal Antibody
TA329941

USD 375.00

5 Days

Rabbit Polyclonal Anti-Bola1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE