Bola1 Rabbit Polyclonal Antibody

CAT#: TA329941

Rabbit Polyclonal Anti-Bola1 Antibody

Product Images

WB Suggested Anti-Bola1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: bolA-like 1 (E. coli)
• Database Link:
  NP_081251
  Entrez Gene 69168 Mouse
  UniProt ID Q9D8S9
• Background: The function of the protein remains unknown.
• Synonyms: CGI-143; MGC75015; OTTHUMP00000013911; OTTHUMP00000013912; RP11-196G18.18
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Human: 79%