Antibodies

View as table Download

Rabbit Polyclonal Anti-CGI Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CGI-143 antibody: synthetic peptide directed towards the N terminal of human CGI-143. Synthetic peptide located within the following region: AGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVV

Rabbit Polyclonal Anti-Bola1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE

BOLA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

BOLA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein