Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-CD83 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD83 Antibody: A synthesized peptide derived from human CD83 |
Antibodies
View as table Download
Anti-CD83 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 20-144 amino acids of human CD83 molecule |
Rabbit Polyclonal Anti-CD83 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD83 antibody is: synthetic peptide directed towards the C-terminal region of Human CD83. Synthetic peptide located within the following region: GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV |
CD83 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-144 of human CD83 (NP_004224.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CD83
Applications
- WB