CD83 Rabbit Polyclonal Antibody

CAT#: TA343115

Rabbit Polyclonal Anti-CD83 Antibody

Product Images

WB Suggested Anti-CD83 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD83 antibody is: synthetic peptide directed towards the C-terminal region of Human CD83. Synthetic peptide located within the following region: GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: CD83 molecule
• Database Link:
  NP_004224
  Entrez Gene 9308 Human
  UniProt ID Q01151
• Background: The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.
• Synonyms: BL11; HB15
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 91%

Reference Data

• Protein Families: Transmembrane