Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-CLK2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLK2. |
CLK2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 290-319 amino acids from the Central region of human CLK2 |
Rabbit Polyclonal Anti-CLK2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CLK2 antibody is: synthetic peptide directed towards the N-terminal region of Human CLK2. Synthetic peptide located within the following region: KFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDF |
CLK2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLK2 |
CLK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 239-498 of human CLK2 (NP_003984.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CLK2
Applications
- WB