Antibodies

View as table Download

Rabbit Polyclonal Anti-ENAH Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Enah antibody is: synthetic peptide directed towards the C-terminal region of Mouse Enah. Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG

Rabbit Polyclonal MENA Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

ENAH Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 412-591 of human ENAH (NP_001008493.1).