Antibodies

View as table Download

Rabbit Polyclonal Anti-F13B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F13B antibody: synthetic peptide directed towards the middle region of human F13B. Synthetic peptide located within the following region: LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP

Rabbit Polyclonal Factor XIII Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Carrier-free (BSA/glycerol-free) F13B mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) F13B mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) F13B mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Factor XIII Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human F13B. AA range:500-550

F13B mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications WB
Reactivities Human
Conjugation Unconjugated

F13B mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications WB
Reactivities Human
Conjugation Unconjugated

F13B mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

F13B mouse monoclonal antibody, clone OTI2H10 (formerly 2H10)

Applications WB
Reactivities Human
Conjugation Unconjugated

F13B mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications WB
Reactivities Human
Conjugation Unconjugated

F13B mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications WB
Reactivities Human
Conjugation Unconjugated