Antibodies

View as table Download

Rabbit Polyclonal Anti-HOXB9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXB9 antibody: synthetic peptide directed towards the N terminal of human HOXB9. Synthetic peptide located within the following region: SPHASGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAV

Rabbit polyclonal anti-HOXB9 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HOXB9.

Rabbit Polyclonal Anti-Hoxb9 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Hoxb9 antibody: synthetic peptide directed towards the n terminal of mouse Hoxb9. Synthetic peptide located within the following region: MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHLDFPSC

HOXB9 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 147-176 amino acids from the Central region of Human HOXB9

Goat Anti-HOXB9 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CEGSEDKERPDQTN, from the internal region of the protein sequence according to NP_076922.1.

Hoxb9 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated

Hoxb9 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

HOXB9 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human HOXB9 (NP_076922.1).
Modifications Unmodified