Antibodies

Jump to Filters
View as table Download
INPP5A Rabbit Polyclonal Antibody
TA333940

USD 375.00

5 Days

Rabbit Polyclonal Anti-INPP5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-INPP5A Antibody is: synthetic peptide directed towards the C-terminal region of Human INPP5A. Synthetic peptide located within the following region: VVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGTALLEFDKELSVF
INPP5A Rabbit Polyclonal Antibody
TA377514

USD 220.00

3 Weeks

INPP5A Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-200 of human INPP5A (NP_005530.3).
Modifications Unmodified