Rabbit Polyclonal Anti-LNX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LNX1 antibody: synthetic peptide directed towards the C terminal of human LNX1. Synthetic peptide located within the following region: SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA |
Carrier-free (BSA/glycerol-free) LNX1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LNX1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
LNX1 mouse monoclonal antibody,clone 1H9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
LNX1 mouse monoclonal antibody,clone 1H9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
LNX1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China