Antibodies

Jump to Filters
View as table Download
LYSMD4 (N-term) Rabbit Polyclonal Antibody
AP52571PU-N

USD 450.00

2 Weeks

LYSMD4 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 40-69 amino acids from the N-terminal region of human LYSMD4
LYSMD4 Rabbit Polyclonal Antibody
TA338855

USD 375.00

5 Days

Rabbit Polyclonal Anti-LYSMD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYSMD4 antibody: synthetic peptide directed towards the N terminal of human LYSMD4. Synthetic peptide located within the following region: PRREQVTWCCCSGSWPRRTASTSWRCSMAANTFYFRPNGAGDTRQNLIPD