Rabbit Polyclonal antibody to MPP2 (membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 486 of MPP2 (Uniprot ID#Q14168) |
Rabbit Polyclonal antibody to MPP2 (membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 11 and 261 of MPP2 |
Rabbit polyclonal Anti-MPP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MPP2 antibody: synthetic peptide directed towards the middle region of human MPP2. Synthetic peptide located within the following region: QGVGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYSFVSRGEME |
Rabbit polyclonal Anti-Mpp2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Mpp2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Mpp2. Synthetic peptide located within the following region: ADLRRTVEESSRIQRGYGHYFDLSLVNSNLERTFRELQTAMEKLRTEPQW |
MPP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human MPP2 (NP_005365.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
