Antibodies

View as table Download

Rabbit polyclonal anti-Musculin antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Musculin.

Goat Anti-MSC / ABF1 Antibody

Applications WB
Reactivities Expected from seq similarity: Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PLKSDWNSLDGIIR, from the C Terminus of the protein sequence according to AAC15071.1.

Rabbit Polyclonal Anti-Musculin Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Musculin Antibody: A synthesized peptide derived from human Musculin

Rabbit Polyclonal Anti-Msc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Msc antibody: synthetic peptide directed towards the C terminal of mouse Msc. Synthetic peptide located within the following region: IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS