Antibodies

View as table Download

Rabbit polyclonal Mst1/2 (Phospho-Thr183) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Mst1/2 around the phosphorylation site of threonine 183 (R-N-TP-V-I).
Modifications Phospho-specific

MST1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 475-505 amino acids from the C-terminal region of human MST1

Rabbit polyclonal Mst1/2 (Ab-183) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Mst1/Mst2 around the phosphorylation site of threonine 183 (R-N-TP-V-I).

MST1 (+MST2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 150-200 of Human MST1.

Rabbit Polyclonal Anti-MST1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MST1 antibody: synthetic peptide directed towards the middle region of human MST1. Synthetic peptide located within the following region: SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE

Rabbit Polyclonal Anti-MST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MST1. Synthetic peptide located within the following region: TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC

Carrier-free (BSA/glycerol-free) MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

MST1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10), HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

MST1 mouse monoclonal antibody, clone OTI1A10 (formerly 1A10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated