NPTN (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human NPTN |
NPTN (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human NPTN |
Rabbit Polyclonal Anti-NPTN Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN |
Rabbit Polyclonal Anti-NPTN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK |
Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-200 of human NPTN (NP_059429.1). |
Modifications | Unmodified |
NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), Biotinylated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), Biotinylated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), Biotinylated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Biotin |
NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | HRP |
NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |