Antibodies

Jump to Filters
View as table Download
PAFAH1B2 Rabbit Polyclonal Antibody
TA344310

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAFAH1B2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAFAH1B2 antibody: synthetic peptide directed towards the N terminal of human PAFAH1B2. Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV
PAFAH1B2 Rabbit Polyclonal Antibody
TA379578

USD 220.00

3 Weeks

PAFAH1B2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-229 of human PAFAH1B2 (NP_002563.1).
Modifications Unmodified