Rabbit Polyclonal Anti-PGAM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PGAM4 Antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM4. Synthetic peptide located within the following region: KDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHG |
Carrier-free (BSA/glycerol-free) PGAM4 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PGAM4 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PGAM4 mouse monoclonal antibody,clone OTI1C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PGAM4 mouse monoclonal antibody,clone OTI1C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PGAM4 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
