PGAM4 Rabbit Polyclonal Antibody

CAT#: TA332249

Rabbit Polyclonal Anti-PGAM4 Antibody

Product Images

Host: Rabbit; Target Name: PGAM4; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PGAM4 Antibody is: synthetic peptide directed towards the C-terminal region of Human PGAM4. Synthetic peptide located within the following region: KDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: phosphoglycerate mutase family member 4
• Database Link:
  NP_001025062
  Entrez Gene 441531 Human
  UniProt ID Q8N0Y7
• Background: This intronless gene appears to have arisen from a retrotransposition event, yet it is thought to be an expressed, protein-coding gene. The encoded protein is a member of the phosphoglycerate mutase family, a set of enzymes that catalyze the transfer of a phosphate group from 3-phosphoglycerate to 2-phosphoglycerate.
• Synonyms: dJ1000K24.1; PGAM-B; PGAM1; PGAM3
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Zebrafish: 86%; Guinea pig: 86%

Reference Data

• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways