Antibodies

View as table Download

Anti-RAD50 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae)

Rabbit polyclonal anti-RAD50 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD50.

Rabbit Polyclonal Antibody against RAD50 (zinc hook domain)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Human Rad50 zinc hook region (amino acids 628-787) expressed in E. coli.

Rabbit Polyclonal Anti-RAD50 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAD50 Antibody is: synthetic peptide directed towards the N-terminal region of Human RAD50. Synthetic peptide located within the following region: SILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDF

Rabbit Polyclonal Rad50 Antibody

Applications WB
Reactivities Human, Mouse, Hamster
Conjugation Unconjugated
Immunogen C-terminal mouse RAD50 (604 amino acids). [UniProt# P70388]

Anti-RAD50 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae)

RAD50 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAD50

Rad50 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human Rad50
Modifications Unmodified

Rad50 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Rad50