Antibodies

View as table Download

SCTR rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCTR

Rabbit polyclonal anti-SCTR antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SCTR.

Rabbit Polyclonal Anti-SCTR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCTR antibody is: synthetic peptide directed towards the N-terminal region of Human SCTR. Synthetic peptide located within the following region: NLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRR

Anti-SCTR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 120-134 amino acids of human secretin receptor