Antibodies

Jump to Filters
View as table Download
C8ORF41 (TTI2) Rabbit Polyclonal Antibody
TA331723

USD 375.00

5 Days

Rabbit Polyclonal Anti-TTI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TTI2 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTI2. Synthetic peptide located within the following region: THSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSV
C8ORF41 (TTI2) Rabbit Polyclonal Antibody
TA361857

USD 360.00

5 Days

TTI2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human C8ORF41