C8ORF41 (TTI2) Rabbit Polyclonal Antibody

CAT#: TA331723

Rabbit Polyclonal Anti-TTI2 Antibody

Product Images

Host: Rabbit; Target Name: TTI2; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TTI2 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTI2. Synthetic peptide located within the following region: THSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: TELO2 interacting protein 2
• Database Link:
  NP_079391
  Entrez Gene 80185 Human
  UniProt ID Q6NXR4
• Background: TTI2 is a regulator of the DNA damage response (DDR). 'TTI2 is part of the TTT complex that is required to stabilize protein levels of the phosphatidylinositol 3-kinase-related protein kinase (PIKK) family proteins. The TTT complex is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and mitomycin C (MMC). 'TTI2, together with the TTT complex and HSP90 may participate in the proper folding of newly synthesized PIKKs.
• Synonyms: C8orf41; MRT39
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Pig: 92%; Rabbit: 75%; Guinea pig: 75%