Mouse Monoclonal Anti-VISTA Antibody [4C4]
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-VISTA Antibody [4C4]
Applications | ELISA, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-C10orf54 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE |
Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI7E9
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI7A6D5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI1D10C1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
C10orf54 mouse monoclonal antibody,clone OTI7E9
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI7E9, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI7E9, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
C10orf54 mouse monoclonal antibody,clone OTI7E9
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C10orf54 mouse monoclonal antibody,clone OTI7A6D5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI7A6D5, Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI7A6D5, HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
C10orf54 mouse monoclonal antibody,clone OTI7A6D5
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
C10orf54 mouse monoclonal antibody,clone OTI1D10C1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI1D10C1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
C10orf54 mouse monoclonal antibody,clone OTI1D10C1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
C10orf54 mouse monoclonal antibody,clone OTI1D10C1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |