Antibodies

View as table Download

Rabbit polyclonal anti-ZNF420 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ZNF420.

Rabbit Polyclonal Anti-ZNF420 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ZNF420 antibody: synthetic peptide directed towards the N terminal of human ZNF420. Synthetic peptide located within the following region: LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

Rabbit Polyclonal Anti-ZNF420 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ZNF420