Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit Polyclonal Anti-ADRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265. |
| Modifications | Phospho-specific |
Rabbit polyclonal PDGFRb (Tyr771) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human: Tyr771, Rat: Tyr770 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PDGFRB around the phosphorylation site of tyrosine 771. |
| Modifications | Phospho-specific |
Rabbit polyclonal PDGFRb (Ab-771) antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PDGFRB. |
Rabbit polyclonal EGFR (Tyr1172) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
| Modifications | Phospho-specific |
Anti-PDGFRB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 212 amino acids of human platelet-derived growth factor receptor, beta polypeptide |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal EGFR (Ser1026) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1026 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Ser1070) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1070 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Ser1071) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1071 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Ser695) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 695 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Thr678) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Threonine 678 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Thr693) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Threonine 693 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1016) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1016 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1092) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1092 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1110) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1110 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1172) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1172 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr1197) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 1197 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Tyr869) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Tyrosine 869 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal PDGFRa Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFRa |
Rabbit Polyclonal PDGFR beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta |
Rabbit Polyclonal PDGFR beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta |
Rabbit Polyclonal PDGFRb Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFRb |
Rabbit Polyclonal PDGFR beta (Tyr740) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta around the phosphorylation site of Tyrosine 740 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Phospho-PDGFR beta (Tyr1021) Antibody (Phospho-specific)
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDGFR beta around the phosphorylation site of Tyrosine 1021 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PDGFRb (Tyr771) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human PDGFRb around the phosphorylation site of Tyrosine 771. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-PDGFRa (Tyr849) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
Rabbit Polyclonal PDGF Receptor beta Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-GJA1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 232-382 amino acids of human gap junction protein, alpha 1, 43kDa |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Gap junction
Availabilities
- In Stock