Antibodies

View as table Download

Rabbit Polyclonal Anti-GNA15 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNA15 antibody: synthetic peptide directed towards the N terminal of human GNA15. Synthetic peptide located within the following region: ARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPG

Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody,clone OTI1D3

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

GNA15 mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated

GNA15 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated