Germany
Japan
United Kingdom
China
Antibodies
Download
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
FAIM2 / LIFEGUARD Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | FAIM2 / LIFEGUARD antibody was raised against synthetic peptide from human FAIM2. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal anti-Phospho-PLB(T17) Antibody
| Applications | Dot |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The PLB Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T17 of human PLB. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Anti-APOL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NNNYKILQADQE, from the C Terminus of the protein sequence according to NP_003652.2; NP_663318.1. |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
USD 380.00
In Stock
Active filters
Category
-
Antibodies
- Primary Antibodies
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Transmembrane
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (26)
- CD44 (13)
- PDGFRB (11)
- MET (10)
- ERBB2 (9)
- FGFR1 (9)
- GRIN2B (9)
- CSF1R (8)
- IGF1R (8)
- CDH1 (7)
- EPHA2 (7)
- APP (6)
- BAX (6)
- BCL2L1 (6)
- GJA1 (6)
- INSR (6)
- NGFR (6)
- TNC (6)
- BCL2 (5)
- CAV1 (5)
- CCR5 (5)
- CD19 (5)
- CYP2D6 (5)
- ERBB3 (5)
- F10 (5)
- F2R (5)
- GRIN1 (5)
- GRM3 (5)
- KDR (5)
- MUC1 (5)
- STX1A (5)
- SYT1 (5)
- ABCB5 (4)
- ABCC2 (4)
- ABCC3 (4)
- BDKRB1 (4)
- CANX (4)
- CDH5 (4)
- CFTR (4)
- CLDN1 (4)
- CLDN7 (4)
- CUX1 (4)
- EIF2AK3 (4)
- EPHA3 (4)
- FASLG (4)
- FGFR2 (4)
- FZD8 (4)
- GLRA1 (4)
- ITGA6 (4)
- KIT (4)
- LPAR3 (4)
- MME (4)
- NOTCH2 (4)
- NTRK1 (4)
- NTRK2 (4)
- ORAI1 (4)
- PECAM1 (4)
- PTGER2 (4)
- PTPRC (4)
- RXFP4 (4)
- S1PR1 (4)
- SCARB1 (4)
- SPAG4 (4)
- TNF (4)
- TRPC6 (4)
- VCAM1 (4)
- ABCD4 (3)
- ACE (3)
- ACVR1C (3)
- ADAM17 (3)
- ADRA2A (3)
- ADRB2 (3)
- ADRB3 (3)
- ANO1 (3)
- APLNR (3)
- APLP2 (3)
- AQP1 (3)
- AQP2 (3)
- AQP3 (3)
- ARMCX1 (3)
- ATP1A1 (3)
- BDNF (3)
- BIK (3)
- BMPR2 (3)
- BSG (3)
- CA14 (3)
- CASR (3)
- CAV2 (3)
- CCR6 (3)
- CD22 (3)
- CD4 (3)
- CD63 (3)
- CDH11 (3)
- CDH23 (3)
- CHRM1 (3)
- CLDN10 (3)
- CLDN19 (3)
- CLDN5 (3)
- CNGA2 (3)
- COX4I1 (3)
Reactivities
- Human (2327)
- Mouse (1515)
- Rat (1239)
- Monkey (47)
- Dog (32)
- Canine (27)
- Pig (19)
- Bovine (18)
- Gorilla (16)
- Cow (13)
- Gibbon (9)
- Chicken (7)
- Zebrafish (7)
- Hamster (6)
- Rabbit (6)
- Chimpanzee (5)
- Horse (5)
- Orang-Utan (4)
- Guinea Pig (3)
- Rhesus Monkey (3)
- Bat (2)
- Sheep (2)
- X. tropicalis (2)
- Xenopus (2)
- Fish (1)
- Goat (1)
- Opossum (1)
- Primate (1)
- Pufferfish (1)
Applications
Antibody Hosts
Modifications
Pathways
- Neuroactive ligand-receptor interaction (242)
- Cytokine-cytokine receptor interaction (240)
- Pathways in cancer (199)
- Calcium signaling pathway (154)
- Endocytosis (122)
- Cell adhesion molecules (CAMs) (121)
- Focal adhesion (118)
- Metabolic pathways (115)
- Colorectal cancer (102)
- MAPK signaling pathway (101)
- Regulation of actin cytoskeleton (100)
- Adherens junction (95)
- Hematopoietic cell lineage (91)
- Olfactory transduction (90)
- Melanoma (78)
- Prostate cancer (77)
- Alzheimer's disease (75)
- Axon guidance (66)
- Gap junction (62)
- Leukocyte transendothelial migration (60)
- Pancreatic cancer (55)
- Jak-STAT signaling pathway (53)
- ErbB signaling pathway (51)
- Glioma (50)
- Melanogenesis (49)
- ABC transporters (48)
- Amyotrophic lateral sclerosis (ALS) (48)
- Apoptosis (48)
- Bladder cancer (47)
- ECM-receptor interaction (46)
- Epithelial cell signaling in Helicobacter pylori infection (45)
- Endometrial cancer (44)
- Huntington's disease (43)
- GnRH signaling pathway (42)
- Wnt signaling pathway (41)
- Dilated cardiomyopathy (39)
- Non-small cell lung cancer (38)
- Natural killer cell mediated cytotoxicity (37)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (36)
- Hypertrophic cardiomyopathy (HCM) (35)
- Neurotrophin signaling pathway (35)
- Vascular smooth muscle contraction (35)
- Basal cell carcinoma (34)
- Chemokine signaling pathway (33)
- Tight junction (32)
- Dorso-ventral axis formation (30)
- Long-term potentiation (29)
- Toll-like receptor signaling pathway (27)
- Systemic lupus erythematosus (26)
- TGF-beta signaling pathway (24)
- Drug metabolism - cytochrome P450 (23)
- Complement and coagulation cascades (21)
- Small cell lung cancer (21)
- Type II diabetes mellitus (21)
- Long-term depression (20)
- Retinol metabolism (20)
- SNARE interactions in vesicular transport (20)
- Parkinson's disease (19)
- Primary immunodeficiency (19)
- Adipocytokine signaling pathway (18)
- Pathogenic Escherichia coli infection (18)
- Taste transduction (18)
- Viral myocarditis (18)
- Chronic myeloid leukemia (17)
- Oocyte meiosis (17)
- PPAR signaling pathway (17)
- Antigen processing and presentation (16)
- Cardiac muscle contraction (16)
- Hedgehog signaling pathway (16)
- Metabolism of xenobiotics by cytochrome P450 (16)
- Oxidative phosphorylation (16)
- Renin-angiotensin system (16)
- Arachidonic acid metabolism (15)
- B cell receptor signaling pathway (15)
- Graft-versus-host disease (15)
- Renal cell carcinoma (15)
- T cell receptor signaling pathway (15)
- p53 signaling pathway (15)
- Fc gamma R-mediated phagocytosis (14)
- Lysosome (14)
- Progesterone-mediated oocyte maturation (14)
- Allograft rejection (13)
- Notch signaling pathway (13)
- Thyroid cancer (13)
- Type I diabetes mellitus (13)
- N-Glycan biosynthesis (12)
- Autoimmune thyroid disease (11)
- Glycerolipid metabolism (10)
- Insulin signaling pathway (10)
- Purine metabolism (10)
- Asthma (9)
- Prion diseases (9)
- Androgen and estrogen metabolism (8)
- Drug metabolism - other enzymes (8)
- Linoleic acid metabolism (8)
- RIG-I-like receptor signaling pathway (8)
- Vibrio cholerae infection (8)
- Acute myeloid leukemia (7)
- Fatty acid metabolism (7)
- Fc epsilon RI signaling pathway (7)
- Glutathione metabolism (7)
- Glycerophospholipid metabolism (7)
- Primary bile acid biosynthesis (7)
- Riboflavin metabolism (7)
- Tryptophan metabolism (7)
- Tyrosine metabolism (7)
- Biosynthesis of unsaturated fatty acids (6)
- Nitrogen metabolism (6)
- Porphyrin and chlorophyll metabolism (6)
- Ascorbate and aldarate metabolism (5)
- Caffeine metabolism (5)
- Cytosolic DNA-sensing pathway (5)
- Ether lipid metabolism (5)
- Sphingolipid metabolism (5)
- Starch and sucrose metabolism (5)
- VEGF signaling pathway (5)
- Chondroitin sulfate biosynthesis (4)
- Glycosphingolipid biosynthesis - lacto and neolacto series (4)
- NOD-like receptor signaling pathway (4)
- Phosphatidylinositol signaling system (4)
- Propanoate metabolism (4)
- Steroid biosynthesis (4)
- Valine (4)
- leucine and isoleucine degradation (4)
- C21-Steroid hormone metabolism (3)
- Glycosphingolipid biosynthesis - ganglio series (3)
- Heparan sulfate biosynthesis (3)
- Keratan sulfate biosynthesis (3)
- Lysine degradation (3)
- Nicotinate and nicotinamide metabolism (3)
- O-Glycan biosynthesis (3)
- Pentose and glucuronate interconversions (3)
- Arginine and proline metabolism (2)
- Butanoate metabolism (2)
- Cell cycle (2)
- Cyanoamino acid metabolism (2)
- Glycolysis / Gluconeogenesis (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Histidine metabolism (2)
- Inositol phosphate metabolism (2)
- Limonene and pinene degradation (2)
- Pantothenate and CoA biosynthesis (2)
- Pyrimidine metabolism (2)
- Pyruvate metabolism (2)
- Selenoamino acid metabolism (2)
- Taurine and hypotaurine metabolism (2)
- Ubiquitin mediated proteolysis (2)
- beta-Alanine metabolism (2)
- Amino sugar and nucleotide sugar metabolism (1)
- Base excision repair (1)
- Glycine (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Maturity onset diabetes of the young (1)
- O-Mannosyl glycan biosynthesis (1)
- Sulfur metabolism (1)
- Terpenoid backbone biosynthesis (1)
- serine and threonine metabolism (1)