Antibodies

Jump to Filters
View as table Download
Cadherin 8 (CDH8) Rabbit Polyclonal Antibody
TA311920

USD 345.00

In Stock

Rabbit polyclonal anti-CDH8 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CDH8.
Cadherin 8 (CDH8) Rabbit Polyclonal Antibody
TA338264

USD 375.00

In Stock

Rabbit Polyclonal Anti-TDO2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK