Cadherin 8 (CDH8) Rabbit Polyclonal Antibody

CAT#: TA338264

Rabbit Polyclonal Anti-TDO2 Antibody

Product Images

WB Suggested Anti-TDO2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1: 62500 Positive Control: Human Fetal Heart

• 

  Rabbit Anti-CDH8 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TDO2 antibody: synthetic peptide directed towards the N terminal of human TDO2. Synthetic peptide located within the following region: MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: cadherin 8
• Database Link:
  NP_001787
  Entrez Gene 1006 Human
  UniProt ID P48775
• Background: This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism. [provided by RefSeq, Feb 2012]
• Synonyms: Nbla04261
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Dog: 79%

Reference Data

• Protein Families: Transmembrane