Antibodies

View as table Download

Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%).

Rabbit polyclonal anti-5-HT-2C antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C.

Rabbit Polyclonal Anti-ADRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GRM1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1

Rabbit Polyclonal Anti-HTR2C Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HTR2C

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated