Antibodies

Jump to Filters
View as table Download
Mu Opioid Receptor (OPRM1) Rabbit Polyclonal Antibody
TA314303

USD 345.00

In Stock

Rabbit polyclonal anti-OPRM1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OPRM1.
Oprm1 Rabbit Polyclonal Antibody
TA338333

USD 375.00

In Stock

Rabbit Polyclonal Anti-Oprm1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV