Oprm1 Rabbit Polyclonal Antibody

CAT#: TA338333

Rabbit Polyclonal Anti-Oprm1 Antibody

Product Images

Host: Rabbit; Target Name: Oprm1; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: opioid receptor, mu 1
• Database Link:
  NP_001034741
  Entrez Gene 18390 Mouse
  UniProt ID P42866
• Background: This gene encodes the mu opioid receptor which is where drugs such as morphine and other opioids have pharmacological effects. Alternatively spliced transcript variants have been found for this gene, however, many of these variants may be NMD candidates.
• Synonyms: hMOP; KIAA0403; LMOR; MOP; MOR; MOR-1; MOR1; OPRM
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Goat: 93%; Sheep: 93%; Rabbit: 93%; Zebrafish: 93%