Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Oprm1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Oprm1 antibody is: synthetic peptide directed towards the middle region of Mouse Oprm1. Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV |
Rabbit Polyclonal mu Opioid R/OPMR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide comprising residues 386-400 of the human, mouse and rat MOR-1 protein. |
Anti-OPRM1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.373~377 (H-P-S-T-A) derived from Human Opioid Receptor. |
Phospho-OPRM1-S375 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S375 of human OPRM1 |
| Modifications | Phospho-specific |
Mu Opioid Receptor(MOR) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human Mu Opioid Receptor(MOR) (NP_000905.3). |
Active filters
Target Symbol
- OPRM1