Antibodies

Jump to Filters
View as table Download
ACSL3 Rabbit Polyclonal Antibody
TA339415

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ACSL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
CPT1A Goat Polyclonal Antibody
TA303144

USD 375.00

2 Weeks

Goat Polyclonal Antibody against CPT1A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPAQTVEQRLKLFK, from the internal region of the protein sequence according to NP_001867.2; NP_001027017.1.
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA324720

USD 450.00

2 Weeks

Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4).