ACSL3 Rabbit Polyclonal Antibody

CAT#: TA339415

Rabbit Polyclonal Anti-ACSL3 Antibody

Product Images

WB Suggested Anti-ACSL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate.There is BioGPS gene expression data showing that ACSL3 is expressed in HEK293T

• 

  Researcher: Received from anonymous; Application: IHC; Species+tissue/cell type: THP-1 derived macrophage; Primary antibody dilution: 1: 200; Secondary antibody: Goat anti-rabbit Alexa Fluor 647; Secondary antibody dilution: 1: 333

• 

  Researcher: Received from anonymous; Application: IHC; Species+tissue/cell type: THP-1 derived macrophage activated with iMtb; Primary antibody dilution: 1: 200; Secondary antibody: Goat anti-rabbit Alexa Fluor 647; Secondary antibody dilution: 1: 333

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 80 kDa
• Gene Name: acyl-CoA synthetase long-chain family member 3
• Database Link:
  NP_004448
  Entrez Gene 2181 Human
  UniProt ID O95573
• Background: The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: ACS3; FACL3; PRO2194
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway