Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8 |
| Modifications | Phospho-specific |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Anti-SOX2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Isotypes
- IgG
Families
- Embryonic stem cells
Citations
- Yes
Filter by
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (4)
- Cell cycle (2)
- Chronic myeloid leukemia (2)
- Colorectal cancer (2)
- MAPK signaling pathway (2)
- TGF-beta signaling pathway (2)
- Wnt signaling pathway (2)
- Acute myeloid leukemia (1)
- Adherens junction (1)
- Basal cell carcinoma (1)
- Bladder cancer (1)
- ECM-receptor interaction (1)
- Endometrial cancer (1)
- ErbB signaling pathway (1)
- Hedgehog signaling pathway (1)
- Hematopoietic cell lineage (1)
- Jak-STAT signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Melanoma (1)
- Pancreatic cancer (1)
- Regulation of actin cytoskeleton (1)
- Small cell lung cancer (1)
- Thyroid cancer (1)