Antibodies

View as table Download

B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%).

Rabbit Polyclonal Anti-CHRM1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CHRM1

Goat Polyclonal Antibody against Bradykinin receptor B1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KVWELYKQCTPK, from the internal region of the protein sequence according to NP_000701.2.

Rabbit anti-CHRM5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRM5

Rabbit Polyclonal Anti-CHRM1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CHRM1

Rabbit polyclonal anti-BDKRB1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BDKRB1.
Modifications Phospho-specific

Rabbit anti-CHRM1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRM1

Goat Anti-F2R / PAR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2.

Rabbit polyclonal anti-CHRM2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHRM2.

CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey, Orang-Utan
Conjugation Unconjugated
Immunogen CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%).

B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla
Conjugation Unconjugated
Immunogen B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%).

Goat Polyclonal Antibody against Cholinergic receptor / CHRM1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DKRRWRKIPKRPGSVH, from the C Terminus of the protein sequence according to NP_000729.2.

Anti-BDKRB2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2

CHRM2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRM2

Rabbit Polyclonal Anti-BDKRB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDKRB2 antibody: synthetic peptide directed towards the N terminal of human BDKRB2. Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV

Rabbit Polyclonal Anti-Thrombin Receptor Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor

Rabbit polyclonal anti-CHRM5 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHRM5.

Rabbit polyclonal Thrombin Receptor antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor.

Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PAR1.

Anti-CHRM2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 208-388 amino acids of human cholinergic receptor, muscarinic 2

Rabbit Polyclonal Thrombin Receptor Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment.

Rabbit Polyclonal Anti-BDKRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ

Rabbit polyclonal anti-CHRM1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CHRM1.
Modifications Phospho-specific

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R.

Rabbit Polyclonal Anti-F2R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA

Rabbit Polyclonal Anti-CHRM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRM1 antibody is: synthetic peptide directed towards the C-terminal region of Human CHRM1. Synthetic peptide located within the following region: VKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKEKKAARTLSAILLAFI

Anti-BDKRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor

Anti-F2R Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor