Thrombin Receptor (F2R) Rabbit Polyclonal Antibody

CAT#: TA342827

Rabbit Polyclonal Anti-F2R Antibody

Product Images

WB Suggested Anti-F2R Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: U937 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: coagulation factor II thrombin receptor
• Database Link:
  NP_001983
  Entrez Gene 2149 Human
  UniProt ID P25116
• Background: Coagulation factor II receptor(F2R) is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member.
• Synonyms: CF2R; HTR; PAR-1; PAR1; TR
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Rabbit: 85%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Calcium signaling pathway, Complement and coagulation cascades, Endocytosis, Neuroactive ligand-receptor interaction, Regulation of actin cytoskeleton