Rabbit Polyclonal Anti-PTP4A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTP4A3 antibody: synthetic peptide directed towards the C terminal of human PTP4A3. Synthetic peptide located within the following region: MKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM |
Anti-PTP4A3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa. 161-166 (K-D-P-H-T) derived from Human PTP4A3. |
PTP4A3 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PRL-3 around the site of 160. |
PTP4A3 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PRL-3 around the site of 160. |
Rabbit Polyclonal Anti-PTP4A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTP4A3 antibody: synthetic peptide directed towards the middle region of human PTP4A3. Synthetic peptide located within the following region: LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR |
Germany
Japan
United Kingdom
China